DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and ciao2a

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_998192.1 Gene:ciao2a / 406300 ZFINID:ZDB-GENE-040426-1965 Length:157 Species:Danio rerio


Alignment Length:148 Identity:69/148 - (46%)
Similarity:93/148 - (62%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KERVLTANEEDENVPDPFDKR---------EIFDLIRNINDPEHPLTLEELHVVQEDLIRI---N 69
            |...||....:.|     |||         |::|:||.|.|||.|.|||||.||.|..:.:   .
Zfish    10 KALFLTGLSNETN-----DKRRKKMEEKALEVYDVIRTIRDPEKPNTLEELDVVTEKCVEVQELG 69

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:..:.|.|:||:||||:||||||.::|||.|.||.:.|:.:.||.|||:.|..:|||:.||||
Zfish    70 DDEYLIVIKFSPTVPHCSLATLIGLCLQVKLQRCLPFKHKLEIYITEGTHSIEEDINKQINDKER 134

  Fly   135 VAAALENNHLAEVINQCI 152
            ||||:||.:|.|::.||:
Zfish   135 VAAAMENPNLREIVEQCV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 69/148 (47%)
ciao2aNP_998192.1 DUF59 <18..152 CDD:294611 65/138 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.