DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and Ciao2a

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001008328.1 Gene:Ciao2a / 300797 RGDID:1307481 Length:160 Species:Rattus norvegicus


Alignment Length:118 Identity:65/118 - (55%)
Similarity:86/118 - (72%) Gaps:3/118 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EIFDLIRNINDPEHPLTLEELHVVQEDLI---RINDSQNSVHISFTPTIPHCSMATLIGLSIRVK 99
            |::||||.|.|||.|.|||||.||.|..:   .|::....|.|.||||:||||:||||||.:|||
  Rat    39 EVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEISEDDYLVIIKFTPTVPHCSLATLIGLCLRVK 103

  Fly   100 LLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCI 152
            |.|.||.:.|:.:.|:.|||::|..:|||:.||||||||:||.:|.|::.||:
  Rat   104 LQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 65/118 (55%)
Ciao2aNP_001008328.1 FeS_assembly_P <39..156 CDD:412662 64/116 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.