DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and ciao-2B

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_499777.1 Gene:ciao-2B / 185814 WormBaseID:WBGene00009736 Length:160 Species:Caenorhabditis elegans


Alignment Length:151 Identity:91/151 - (60%)
Similarity:122/151 - (80%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IENINPNVYD-RIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR- 67
            ::|.||.::| :.:.|.:|..|.||:|.||.|..|||||||:|||||||.|||:|:||||:||: 
 Worm     6 LDNANPTLFDSKPRHRPVTGTERDESVEDPIDSWEIFDLIRDINDPEHPYTLEQLNVVQEELIKV 70

  Fly    68 -INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLAD 131
             |::.:..|.::||||||||||||||||:|||||||||.|:.||:|.||||:|::|.::|:||||
 Worm    71 FIDEEETFVKVNFTPTIPHCSMATLIGLAIRVKLLRSLHPKVKVSVSITPGSHSTEESINRQLAD 135

  Fly   132 KERVAAALENNHLAEVINQCI 152
            |||||||:||..|...:|:|:
 Worm   136 KERVAAAMENQGLMHAVNECL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 91/151 (60%)
ciao-2BNP_499777.1 DUF59 <34..156 CDD:294611 80/121 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164046
Domainoid 1 1.000 111 1.000 Domainoid score I3933
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 188 1.000 Inparanoid score I2591
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto20226
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.