DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and ciao2a

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_002932995.1 Gene:ciao2a / 100489623 XenbaseID:XB-GENE-5812283 Length:151 Species:Xenopus tropicalis


Alignment Length:123 Identity:63/123 - (51%)
Similarity:88/123 - (71%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DKR--EIFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQNS---VHISFTPTIPHCSMATLIGL 94
            |:|  |::|:||||.|||.|.|||:|.||.|..:.:.:....   |.|.||||:||||:||||||
 Frog    25 DERALEVYDIIRNIRDPEKPNTLEDLDVVSESCVSVQELDEECYLVVIRFTPTVPHCSLATLIGL 89

  Fly    95 SIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCI 152
            .:||||.|.|..:.|:.:.|:.|||::|..:|||:.|||||:||:||.:|.|::.||:
 Frog    90 CLRVKLQRCLSFKHKLEIYISEGTHSTEEDINKQINDKERVSAAMENPNLREIVEQCV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 63/123 (51%)
ciao2aXP_002932995.1 FeS_assembly_P <30..147 CDD:382298 60/116 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.