DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos4 and Bloc1s4

DIOPT Version :10

Sequence 1:NP_648414.1 Gene:Blos4 / 39219 FlyBaseID:FBgn0036105 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_598485.1 Gene:Bloc1s4 / 117197 MGIID:1929230 Length:215 Species:Mus musculus


Alignment Length:158 Identity:40/158 - (25%)
Similarity:77/158 - (48%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IENVSRDYA-KILQSADLEKEINPLCTNIEDMLARLDEFETLLASVRAESNGMMANNVCSILGFT 68
            :...:..|| .:|.||....|:..|..::|::||::|||..:|..:|.:|:.::...|..|....
Mouse    60 LRRAASGYASSLLPSAGPRPEVEALDASLEELLAKVDEFVGMLDMIRGDSSHVVGEGVPRIHAKA 124

  Fly    69 DSFEQLKARIDGLEQCVGVVSANLSEVERSVDIAEEELHVTDYSLKGLLLKPLKAKLSASDTSTL 133
            ....::..|||.||..|.::.::::.:|..|..||.||.....:.:.||           .|.::
Mouse   125 AEMRRIYGRIDKLEAFVRMIGSSVARMEEQVAKAEAELGTFPRAFRRLL-----------HTISV 178

  Fly   134 SSLPR---SNLVEEEYQPVEIYKSDDYF 158
            .:|.|   |......|:|..:::::|:|
Mouse   179 PALFRSAPSGPQRAAYEPPVLFRTEDHF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos4NP_648414.1 None
Bloc1s4NP_598485.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.