DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tna and PIAS2

DIOPT Version :9

Sequence 1:NP_001368945.1 Gene:tna / 39217 FlyBaseID:FBgn0026160 Length:1186 Species:Drosophila melanogaster
Sequence 2:XP_006722634.1 Gene:PIAS2 / 9063 HGNCID:17311 Length:661 Species:Homo sapiens


Alignment Length:608 Identity:132/608 - (21%)
Similarity:221/608 - (36%) Gaps:158/608 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 GGMCPAGPGAVATTGNPYQNQGFQQNYQHSPVPGNPTPPLTPACSVPYV------------SPNP 599
            ||..|..|. :|..|            .|| :|.....|.:|:..|..|            .|:|
Human   126 GGSSPVEPD-LAVAG------------IHS-LPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSP 176

  Fly   600 DIKPPMDNSEEMRLTFPVRD--GIILAPFRLLHNLSVSN-----HVFHL-KQNVYNTLMCRNDL- 655
            .| ||:....::: ..|..|  .:::.|..|:.: |:..     .:|.| .|.|....:.|:.| 
Human   177 PI-PPVHPDVQLK-NLPFYDVLDVLIKPTSLVQS-SIQRFQEKFFIFALTPQQVREICISRDFLP 238

  Fly   656 --------ELQLK-CFHQDDRQMNTNWPHTVTVSAN----------------------ATPLNIE 689
                    ::||: |..:.......|:|:::.:..|                      ..||||.
Human   239 GGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNIT 303

  Fly   690 RSEKNSTALRPLYLKAVCQPGRNTLQLT-ASSCCCSHLFVLQLVHRPSVRQVLQTLHKRNLLPLE 753
            ...:.|:|:            .|.:.:: ||....::...:.||.:.:...:||.|..:.:...:
Human   304 SLVRLSSAV------------PNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPD 356

  Fly   754 HSVQKIKRNLSQPEANAGPD---ATPQQQQQQGGGQQCAKISLKCPITKSRIRLPARGHECKHVQ 815
            ||...||..|:     |.||   ||..           .::||.||:.|.|:.:|.|...|.|:|
Human   357 HSRALIKEKLT-----ADPDSEIATTS-----------LRVSLMCPLGKMRLTIPCRAVTCTHLQ 405

  Fly   816 CFDLEAYLMINSERGSWRCPECSKSAITDTLEIDQYIWAILNTLGNSDVDEVIIDSSANWRALQH 880
            |||...||.:|.::.:|.||.|.|.|..::|.:|.....|||..  |||||:......:|..::.
Human   406 CFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC--SDVDEIKFQEDGSWCPMRP 468

  Fly   881 NGGMPNAPPPSNVPSNPSGGSGSNSGNGSVNPTLPVIKQELCDDIAKVMSPGSTQLPTWDSAQAM 945
            .   ..|...|:.|......|...|...||.......|:::  |:..:....|:.......|:..
Human   469 K---KEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKV--DVIDLTIESSSDEEEDPPAKRK 528

  Fly   946 SPYNMHDMNSIASGNMMGNGGNTNQHGNRSSYDGFSGNHSDGSGGLPGGDGGVNSLDQLNAMEKS 1010
            ..:.....:|...|.:|                     :...|..:|    .|.|:|.. |:..|
Human   529 CIFMSETQSSPTKGVLM---------------------YQPSSVRVP----SVTSVDPA-AIPPS 567

  Fly  1011 LSDQMPHTPHTPGAASHPMTPG--------------GPPSVSSSHNEPISGG-----TPNANGSG 1056
            |:|......|||.::.....||              .||....|...|::..     |.:::.|.
Human   568 LTDYSVPFHHTPISSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSSHESS 632

  Fly  1057 SATNGSGNNN-----SSTGHNSP 1074
            :..:.|.:.:     :|:|.|.|
Human   633 THVSSSSSRSETGVITSSGSNIP 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnaNP_001368945.1 Med15 216..>604 CDD:312941 16/68 (24%)
SP-RING_ZMIZ 792..839 CDD:319705 21/46 (46%)
PIAS2XP_006722634.1 SAP 50..84 CDD:128789
PINIT 184..321 CDD:291022 24/150 (16%)
zf-MIZ 381..429 CDD:280964 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3884
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.