DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tna and pias4b

DIOPT Version :9

Sequence 1:NP_001368945.1 Gene:tna / 39217 FlyBaseID:FBgn0026160 Length:1186 Species:Drosophila melanogaster
Sequence 2:NP_956637.2 Gene:pias4b / 393314 ZFINID:ZDB-GENE-040426-1298 Length:485 Species:Danio rerio


Alignment Length:331 Identity:84/331 - (25%)
Similarity:136/331 - (41%) Gaps:49/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 VSPNPDIKPPMDNSEEMRLTFPVRDGIILAPFRLLHN----LSVSNHVFHLKQN----VYNTLMC 651
            :||.....|.....:.::|.|......|:.|..|:..    :..|:.:|||.::    :.|:   
Zfish   114 LSPGGTPSPKSAGPQMIKLPFYQMLETIIPPTPLVPTYGGAMQNSDFLFHLSESQQALIQNS--- 175

  Fly   652 RNDLELQLK---CFHQDDRQMNTNWPHTVTVSANATPLNIERS-EKNSTALRPLYLKAVCQPGRN 712
            |:...:|:.   |:.:........:|..:.||.|.....::.: ..|...|.|   ...|:|...
Zfish   176 RSSQPVQVVLRICYSESIGVEEDQYPPNICVSVNHNNCPVQCTYSSNKLGLEP---SRPCRPIDI 237

  Fly   713 TLQLTAS----------SCCCSHLFVLQLVHRPSVRQVLQTLHKRNLLPLEHSVQKIKRNL-SQP 766
            |..|..|          :...|:...:.||...|.:|:|..|...::...:....::...| |.|
Zfish   238 TSDLYLSFTNRFTVLWGNFGKSYSVAVYLVRLVSCQQLLDQLRSSSVEQQDVCRLRVSEKLRSDP 302

  Fly   767 EANAGPDATPQQQQQQGGGQQCAKISLKCPITKSRIRLPARGHECKHVQCFDLEAYLMINSERGS 831
            |...   ||...|           :||.||:.|.|:.:|.|...|.|:||||...||.:|.::..
Zfish   303 ETEV---ATTGLQ-----------VSLICPLVKLRMSVPCRSRGCAHLQCFDASFYLQMNEKKPR 353

  Fly   832 WRCPECSKSAITDTLEIDQYIWAILNTLGNSDVDEVIIDSSANWRALQH-----NGGMPNAPPPS 891
            |.||.|.:.|..|.|.||..:..:|.:.| .||:|:...|.:.|:|::|     |.|....|...
Zfish   354 WSCPVCHRYAPFDELRIDSLLRDVLESSG-EDVEEIKYLSDSTWKAVKHDKSNQNKGSALHPVKH 417

  Fly   892 NVPSNP 897
            ||.|.|
Zfish   418 NVNSKP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnaNP_001368945.1 Med15 216..>604 CDD:312941 2/8 (25%)
SP-RING_ZMIZ 792..839 CDD:319705 21/46 (46%)
pias4bNP_956637.2 SAP 42..76 CDD:128789
PINIT 131..260 CDD:291022 25/134 (19%)
zf-MIZ 313..360 CDD:280964 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.