DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tna and Pias4

DIOPT Version :9

Sequence 1:NP_001368945.1 Gene:tna / 39217 FlyBaseID:FBgn0026160 Length:1186 Species:Drosophila melanogaster
Sequence 2:NP_001094227.1 Gene:Pias4 / 362827 RGDID:1308737 Length:507 Species:Rattus norvegicus


Alignment Length:506 Identity:112/506 - (22%)
Similarity:185/506 - (36%) Gaps:141/506 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 YQNQGFQQNYQHSPVPGNPTPPLT-----------PACSVP-----YVS-----PNPDIKPPMDN 607
            |:.:..:::.:..|....|..||.           |....|     |::     |...:||    
  Rat    62 YETRYAKKSAEPGPQAPRPLDPLALHSMPRTPLSGPTVDYPVLYGKYLNGLGRLPTKALKP---- 122

  Fly   608 SEEMRLT----FPVRDGIILAPFRLL----HNLSVSNHVFHLKQNVYNTLMCRNDLELQ------ 658
              |:||.    |.:.|. :|.|..|:    ..|..|..:|.|...  ...|.||..|||      
  Rat   123 --EVRLVKLPFFNMLDE-LLKPTELVPQSAEKLQESPCIFALTPR--QVEMIRNSRELQPGVKAV 182

  Fly   659 ---LK-CFHQDDRQMNTNWPHTVTVSANATPLNIE-RSEKNSTALRPLYLKAVCQP--------- 709
               |: |:..........:|..:.|..|.:..::. ....|...:.|   |..|:|         
  Rat   183 QVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEP---KRPCRPINLTHLMYL 244

  Fly   710 --GRNTLQLTASSCCCSHLFVLQLVHRPSVRQVLQTLHKRNLLPLEHSVQKIKRNLSQPEANAGP 772
              ..|.:.:|..:...|:...|.||.:.:...:||.|   ..:.::|  .::.:.|.:.:....|
  Rat   245 SSATNRITVTWGNYGKSYSVALYLVRQLTSSDLLQRL---KTIGVKH--PELCKALVKEKLRLDP 304

  Fly   773 DATPQQQQQQGGGQQCAKISLKCPITKSRIRLPARGHECKHVQCFDLEAYLMINSERGSWRCPEC 837
            |:   :....|     .::||.||:.|.|:.:|.|...|.|:||||...||.:|.::.:|.||.|
  Rat   305 DS---EIATTG-----VRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVC 361

  Fly   838 SKSAITDTLEIDQYIWAILNTLGNSDVDEVIIDSSANWRALQHNGGMPNAPPPSNVPSNPSGGSG 902
            .|.|..|.|.||..:..||:..  .|.||:...:..:||.::..      ..||..|..|....|
  Rat   362 DKPAAYDQLIIDGLLSKILSEC--EDADEIEFLAEGSWRPIRAE------KEPSCSPQGPILVLG 418

  Fly   903 SNSGNGSVNPTLPVIKQELCDDIAKVMSPGSTQLPTWDSAQAMSPYNMHDMNSIASGNMMGNGGN 967
            ::..||                    ::|.|:           :|       .:.|| :.|.|| 
  Rat   419 TSDANG--------------------LAPASS-----------TP-------GMGSG-LSGPGG- 443

  Fly   968 TNQHGNRSSYDGFSGNHSDGSGGLPGGDGGVN----SLDQLNAMEKSLSDQ 1014
                         :|..:..:|||..|..|.:    :||..::.|....|:
  Rat   444 -------------AGGGAGAAGGLENGKTGADVVDLTLDSSSSSEDEDEDE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnaNP_001368945.1 Med15 216..>604 CDD:312941 10/60 (17%)
SP-RING_ZMIZ 792..839 CDD:319705 21/46 (46%)
Pias4NP_001094227.1 SAP 12..46 CDD:128789
PINIT 124..262 CDD:291022 29/143 (20%)
zf-MIZ 315..364 CDD:280964 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.