DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and si:dkey-93l1.9

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001352013.1 Gene:si:dkey-93l1.9 / 562339 ZFINID:ZDB-GENE-090313-355 Length:108 Species:Danio rerio


Alignment Length:101 Identity:36/101 - (35%)
Similarity:62/101 - (61%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VNAYQHKKTLAQGMMDLALLSANANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNG 193
            :|.|..||:.||.|:|:|||.||::||:.||.:.:||.::...:..||:||..|:.||:.||...
Zfish     1 MNDYASKKSAAQSMLDVALLMANSSQLKTVLHSGAQHRFYTTLIALISISISLQLIVGLLLIFIV 65

  Fly   194 QYNIKNGHDICRANRINNYTVSGIFIVTVVNVLISA 229
            :.::.:.....|.|.:||.....:|...::|::|:|
Zfish    66 KSDLNDVKQQPRLNTMNNMATVFVFFTVLINIIITA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 36/100 (36%)
si:dkey-93l1.9NP_001352013.1 Ninjurin 2..102 CDD:309864 36/100 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.