DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and ninj1

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001008021.2 Gene:ninj1 / 493383 XenbaseID:XB-GENE-959247 Length:146 Species:Xenopus tropicalis


Alignment Length:150 Identity:49/150 - (32%)
Similarity:78/150 - (52%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NG-GNGGNVNVNVPNGGRRPSFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLS 149
            || |.|.|..:|.....|||.                      ::|.|.:||::|:.|:|:|||.
 Frog    11 NGLGPGENSALNPEVTARRPL----------------------NINHYANKKSVAESMLDVALLM 53

  Fly   150 ANANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRANRINNYTV 214
            |||:|::.|::......|:.|.|:.||:|.:.|:.|||.||...:|::.|.......:.:.|...
 Frog    54 ANASQMKAVIDQGPSFSYYVPLLVLISISFVLQVIVGVLLIFIVKYDLNNPAKHYILDILENTAT 118

  Fly   215 SGIFIVTVVNVLISAFTVDR 234
            ..:||:.|||||::||.|.:
 Frog   119 GLVFIIVVVNVLVTAFGVQK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 37/99 (37%)
ninj1NP_001008021.2 Ninjurin 34..134 CDD:368193 37/99 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm9364
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.