DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and NINJ1

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_004139.2 Gene:NINJ1 / 4814 HGNCID:7824 Length:152 Species:Homo sapiens


Alignment Length:154 Identity:53/154 - (34%)
Similarity:80/154 - (51%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NGGRRPSFSFPG-----------YNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSANA 152
            |||..|  ..||           .:||    ||        ||.|..||:.|:.|:|:|||.|||
Human    11 NGGLPP--GTPGSPDASPARWGWRHGP----IN--------VNHYASKKSAAESMLDIALLMANA 61

  Fly   153 NQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRANRINNYTVSGI 217
            :||:.|:|......::.|.::.||:|::.||.|||.||...:|::.|.....:.:.:||.....:
Human    62 SQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLV 126

  Fly   218 FIVTVVNVLISAFTVDRDTVPALP 241
            ||:.|||:.|:||.|.:..:...|
Human   127 FIIVVVNIFITAFGVQKPLMDMAP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 38/99 (38%)
NINJ1NP_004139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 6/16 (38%)
N-terminal adhesion motif. /evidence=ECO:0000269|PubMed:33028854 26..37 2/14 (14%)
Ninjurin 39..139 CDD:309864 38/99 (38%)
Required to induce plasma membrane rupture. /evidence=ECO:0000250|UniProtKB:O70131 40..69 15/28 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BDMP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm8469
orthoMCL 1 0.900 - - OOG6_103284
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.