DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and NijB

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster


Alignment Length:179 Identity:52/179 - (29%)
Similarity:88/179 - (49%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DNPGVDDGLFSTVGGN-GGNGGNVNVNVPNGGRRPSFSFPGYNGPGFVTINGVE---------TP 125
            |:|...:...||..|. .|:|.::::.|.....:.. .||..     .|....|         :.
  Fly    12 DSPSSGESFASTTSGPCCGSGRDLDIQVHESHIKDD-QFPSR-----ATSELQESKKSNKKCSSD 70

  Fly   126 IPDVNAYQHKKTLAQGMMDLALLSANANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLI 190
            :...|:|...|.:|:|:||:|||||||||||:::..:.:...:..|::.:.||::.|:.||:.||
  Fly    71 LSTENSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYSMIMVILSLVLQLLVGIMLI 135

  Fly   191 L--------NGQYNIKNGHDICRANRINNYTVSGIFIVTVVNVLISAFT 231
            .        |..|           .|.|:..|.|:|::||:|:|::|||
  Fly   136 FKRRLKRFRNRSY-----------ERTNDLLVMGVFMITVINILLAAFT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 37/107 (35%)
NijBNP_649068.1 Ninjurin 75..172 CDD:282740 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111172at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.