DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and Ninj1

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_036999.1 Gene:Ninj1 / 25338 RGDID:3179 Length:152 Species:Rattus norvegicus


Alignment Length:144 Identity:54/144 - (37%)
Similarity:85/144 - (59%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NGGRRP-SFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSANANQLRYVLETS 162
            ||..|| |...|..:.|.:...|   .|| :||.|.:||:.|:.|:|:|||.|||:||:.|:|..
  Rat    11 NGDLRPGSPGSPDASPPRWGLRN---RPI-NVNHYANKKSAAESMLDIALLMANASQLKAVVEQG 71

  Fly   163 SQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRANRINNYTVSGIFIVTVVNVLI 227
            ::..:|.|.::.||:|::.||.|||.||...:|::.|.....:.:.:||.....:||:.|||:.|
  Rat    72 NEFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFI 136

  Fly   228 SAFTVDRDTVPALP 241
            :||.|.:..:...|
  Rat   137 TAFGVQKPVMDVAP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 39/99 (39%)
Ninj1NP_036999.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 7/18 (39%)
N-terminal adhesion motif. /evidence=ECO:0000269|PubMed:33028854 26..37 4/14 (29%)
Ninjurin 39..139 CDD:398538 39/99 (39%)
Required to induce plasma membrane rupture. /evidence=ECO:0000250|UniProtKB:O70131 40..69 15/28 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7960
eggNOG 1 0.900 - - E1_2BDMP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm8945
orthoMCL 1 0.900 - - OOG6_103284
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.