DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and Ninj1

DIOPT Version :10

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001423169.1 Gene:Ninj1 / 18081 MGIID:1196617 Length:210 Species:Mus musculus


Alignment Length:117 Identity:46/117 - (39%)
Similarity:74/117 - (63%) Gaps:1/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PIPDVNAYQHKKTLAQGMMDLALLSANANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGL 189
            || :||.|.:||:.|:.|:|:|||.|||:||:.|:|..:...:|.|.::.||:|::.||.|||.|
Mouse    93 PI-NVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLL 156

  Fly   190 ILNGQYNIKNGHDICRANRINNYTVSGIFIVTVVNVLISAFTVDRDTVPALP 241
            |...:|::.|.....:.:.:||.....:||:.|||:.|:||.|.:..:...|
Mouse   157 IFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 129..230 CDD:461482 40/100 (40%)
Ninj1NP_001423169.1 Ninjurin 96..197 CDD:461482 40/100 (40%)

Return to query results.
Submit another query.