DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and Ninj1

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_038638.1 Gene:Ninj1 / 18081 MGIID:1196617 Length:152 Species:Mus musculus


Alignment Length:144 Identity:54/144 - (37%)
Similarity:83/144 - (57%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NGGRRP-SFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSANANQLRYVLETS 162
            ||..|| |...|....|.:...|   .|| :||.|.:||:.|:.|:|:|||.|||:||:.|:|..
Mouse    11 NGDLRPGSPGSPDALPPRWGLRN---RPI-NVNHYANKKSAAESMLDIALLMANASQLKAVVEQG 71

  Fly   163 SQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRANRINNYTVSGIFIVTVVNVLI 227
            :...:|.|.::.||:|::.||.|||.||...:|::.|.....:.:.:||.....:||:.|||:.|
Mouse    72 NDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFI 136

  Fly   228 SAFTVDRDTVPALP 241
            :||.|.:..:...|
Mouse   137 TAFGVQKPVMDVAP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 39/99 (39%)
Ninj1NP_038638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 7/17 (41%)
N-terminal adhesion motif. /evidence=ECO:0000250|UniProtKB:Q92982 26..37 4/14 (29%)
Ninjurin 39..139 CDD:309864 39/99 (39%)
Required to induce plasma membrane rupture. /evidence=ECO:0000269|PubMed:33472215 40..69 15/28 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8080
eggNOG 1 0.900 - - E1_2BDMP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm8708
orthoMCL 1 0.900 - - OOG6_103284
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.