DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and ninj2

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_031754494.1 Gene:ninj2 / 101732128 -ID:- Length:171 Species:Xenopus tropicalis


Alignment Length:148 Identity:41/148 - (27%)
Similarity:71/148 - (47%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GGNGGNVNVNVPNGGRRPSFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSAN 151
            |..|..:::.|.|..|....:.                   ::|.|..||:||:.|:|:||..||
 Frog    35 GTEGERISMEVDNRRRERGSAL-------------------NINHYATKKSLAESMLDVALFMAN 80

  Fly   152 ANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRANRINNYTVSG 216
            ..||:.|||......|:...:..||:|:..||.:|:.||:..:.|:.:.....:.|.:||.....
 Frog    81 TAQLKAVLEQGPSFTYYITLITLISISLALQIVIGILLIIIARKNLNDVSKQPQLNVLNNAATGL 145

  Fly   217 IFIVTVVNVLISAFTVDR 234
            :|:..::|:.|:||.|.:
 Frog   146 VFLTVLINIFITAFGVQK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 33/99 (33%)
ninj2XP_031754494.1 Ninjurin 59..159 CDD:398538 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm9364
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.