DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijA and ninj1

DIOPT Version :9

Sequence 1:NP_996040.1 Gene:NijA / 39215 FlyBaseID:FBgn0036101 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_021335558.1 Gene:ninj1 / 100150223 ZFINID:ZDB-GENE-141216-96 Length:161 Species:Danio rerio


Alignment Length:158 Identity:52/158 - (32%)
Similarity:79/158 - (50%) Gaps:23/158 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DGLFSTVGGNGGNGGNVNVNVPNGGRRPSFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQG 141
            ||:...:|...|:...     |..||...                 .||: ::|.|.:||:.|:.
Zfish    21 DGMELLIGNRAGSAER-----PQQGRMSR-----------------NTPL-NMNHYANKKSAAES 62

  Fly   142 MMDLALLSANANQLRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDICRA 206
            |:|:|||.|||:||:.|||......::.|.:..||:|:..||.||:.||...::|:.:.......
Zfish    63 MLDIALLMANASQLKTVLELGPSFSFYIPLITLISISLTLQIIVGILLIFIVKWNLNDSSKHYIL 127

  Fly   207 NRINNYTVSGIFIVTVVNVLISAFTVDR 234
            |.:.|...:.:|||.||||.|:||.|.|
Zfish   128 NLLENIVTALVFIVVVVNVFITAFGVQR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijANP_996040.1 Ninjurin 130..230 CDD:282740 39/99 (39%)
ninj1XP_021335558.1 Ninjurin 51..137 CDD:309864 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 1 1.000 - - FOG0001262
OrthoInspector 1 1.000 - - mtm6411
orthoMCL 1 0.900 - - OOG6_103284
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.