DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and DLG5

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_004738.3 Gene:DLG5 / 9231 HGNCID:2904 Length:1919 Species:Homo sapiens


Alignment Length:190 Identity:47/190 - (24%)
Similarity:80/190 - (42%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALSSSS----SSSSAAASLTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTT 71
            |.||.|    ..|.:.|....:|:.....||:::.||.   ...:.:.|..|.|..|       .
Human  1711 AFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPL---LDVVKEMLVNEAPGKF-------C 1765

  Fly    72 RKPREGEEHGVHYYFVERPEMEAAIAGDE---FIETAEFTGNLYGTSKAAVREIQAQGRVCILDI 133
            |.|.|          |.:...:|...|.:   |::....:|:...|:.|:::||..:.|.|:|||
Human  1766 RCPLE----------VMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDI 1820

  Fly   134 EQKGVEQIKRTDLNPILIF---NNPPSIKELERRLRKRGSETEESLSKRLNAAQ-VELDY 189
            ....:|::....:.||:||   .:...|||....:..|...|:....::..||| :|.:|
Human  1821 APHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEY 1880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 40/163 (25%)
guanyl_kin 36..216 CDD:213788 40/161 (25%)
DLG5NP_004738.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..142
Takusan 130..212 CDD:282652
TPR_MLP1_2 231..353 CDD:285204
COG1340 295..587 CDD:224259
FliJ 310..449 CDD:304890
BAR 417..601 CDD:299863
PDZ_signaling 620..707 CDD:238492
DegQ <702..771 CDD:223343
PDZ_signaling 722..790 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 927..1122
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1150..1187
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1201..1230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1245..1264
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1306
PDZ 1347..1429 CDD:214570
dbPDZ_assoc 1427..1499 CDD:293216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1434..1493
PDZ 1499..1582 CDD:214570
SH3_DLG5 1597..1659 CDD:212794
GuKc 1732..1908 CDD:214504 41/169 (24%)
Guanylate_kin 1740..1907 CDD:279019 40/161 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.