DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and CARD11

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001311210.1 Gene:CARD11 / 84433 HGNCID:16393 Length:1154 Species:Homo sapiens


Alignment Length:253 Identity:49/253 - (19%)
Similarity:100/253 - (39%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RALSSSSSSSSAAASLTSKKMTAPGPRPLVLCGP-SGSGKS------TLLKRLFAE--FPSTFGF 65
            |.:|.|...|.|.:||.:.|:.......|   .| |..||:      :|::..:.|  .|..|..
Human   920 RIISGSPLGSLARSSLDATKLLTEKQEEL---DPESELGKNLSLIPYSLVRAFYCERRRPVLFTP 981

  Fly    66 SISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSK----------AAVR 120
            ::...|...|.....|...:.:.:.::   :..|||:...:....:|...|          |.:.
Human   982 TVLAKTLVQRLLNSGGAMEFTICKSDI---VTRDEFLRRQKTETIIYSREKNPNAFECIAPANIE 1043

  Fly   121 EIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRK-----RGSETEESLSKRL 180
            .:.|:.:.|:|:........:.::::.||::|     |:..|:.:::     ...||||...:..
Human  1044 AVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLF-----IRVCEKNIKRFRKLLPRPETEEEFLRVC 1103

  Fly   181 NAAQVELD-----YGLTPGNFHKIINNVDIDV--AYEEFRNFVVQELKEQQKQGVSVN 231
            ...:.||:     |.           .|:.|:  :.||....|..::.|:|::.:.|:
Human  1104 RLKEKELEALPCLYA-----------TVEPDMWGSVEELLRVVKDKIGEEQRKTIWVD 1150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 38/215 (18%)
guanyl_kin 36..216 CDD:213788 37/210 (18%)
CARD11NP_001311210.1 CARD_CARD11_CARMA1 22..107 CDD:260070
Linker. /evidence=ECO:0000305|PubMed:31296852 111..128
BAR <173..>257 CDD:299863
GBP_C <252..418 CDD:303769
coiled coil 387..398 CDD:293879
coiled coil 407..418 CDD:293879
Inhibitory domain (ID). /evidence=ECO:0000303|PubMed:31296852 450..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..626
PDZ_signaling 680..752 CDD:238492
SH3 777..839 CDD:302595
NK <1009..1143 CDD:302627 27/149 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.