DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and AT3G06200

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_566276.1 Gene:AT3G06200 / 819794 AraportID:AT3G06200 Length:282 Species:Arabidopsis thaliana


Alignment Length:280 Identity:70/280 - (25%)
Similarity:110/280 - (39%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RALSSSSSSS--------------------SAAASLTSKKMT---APG----------------- 34
            |.|.||.|.|                    |:|.|.:|.|||   .||                 
plant     3 RKLCSSFSRSIIFPNKPIFIPRSFPQPLRHSSALSYSSLKMTDTHIPGNPNSSPIQSPTKPESLR 67

  Fly    35 ----------------PRP----LVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEE 79
                            |.|    :|:.||||.||..::.:| .|......|.::.|:|..|.||.
plant    68 SLEFQLGSSFTADPIIPPPNQIVIVISGPSGVGKDAVINKL-REVREGLHFVVTATSRPMRPGEV 131

  Fly    80 HGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRT 144
            .|..|:||.|.:..:.:..:|.:|.|...|...|..|..::|..|:|...:|.::.:|.:.::|.
plant   132 DGKDYFFVSRDQFLSMVENEELLEYALVYGEYKGIPKKQIQEFMAKGEDIVLRVDIQGAQTLRRI 196

  Fly   145 DLN-PILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVEL------DYGL--TPGNFHKII 200
            ..| .:.||....|...:..||..|.:|::|.|..|:..|:.|:      ||.:  ..|.....:
plant   197 LGNSAVFIFLVAESELAMVERLIDRKTESQEELLVRVATAREEVRHLKNFDYVVVNAKGRLDDAV 261

  Fly   201 NNVD--IDVAYEEFRNFVVQ 218
            |.|:  ||....:....:|:
plant   262 NRVESIIDAEKSKVHQRIVR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 56/233 (24%)
guanyl_kin 36..216 CDD:213788 53/194 (27%)
AT3G06200NP_566276.1 NK 85..280 CDD:418433 53/195 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2468
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522834at2759
OrthoFinder 1 1.000 - - FOG0002663
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100603
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.730

Return to query results.
Submit another query.