DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and GK-1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001323630.1 Gene:GK-1 / 818788 AraportID:AT2G41880 Length:416 Species:Arabidopsis thaliana


Alignment Length:219 Identity:88/219 - (40%)
Similarity:123/219 - (56%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPE 91
            ||.:.....:|:|:.||||.||.||:..|..||||.||||:|||||.||..|..||||:|.::..
plant   129 SKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMDGVHYHFADKKV 193

  Fly    92 MEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRV---------------------------- 128
            ||..|...:|:|.|...|||||||..:|..:...|:|                            
plant   194 MEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKVYKKAFGLITDAFCVFDLLNNEFCFCPTQ 258

  Fly   129 -CILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVELDYGLT 192
             |||||:.:|...::.:.|:.|.||..|||:||||.|||.||:||||.:.|||..|:.|:..|::
plant   259 RCILDIDVQGARSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGIS 323

  Fly   193 PGNFHKIINNVDIDVAYEEFRNFV 216
            .|.|..|:.|.:::..|::.:|.:
plant   324 SGIFGLILYNDNLEECYKKLKNLL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 86/212 (41%)
guanyl_kin 36..216 CDD:213788 86/208 (41%)
GK-1NP_001323630.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 175 1.000 Domainoid score I1098
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H665
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522834at2759
OrthoFinder 1 1.000 - - FOG0002663
OrthoInspector 1 1.000 - - otm3289
orthoMCL 1 0.900 - - OOG6_100603
Panther 1 1.100 - - O PTHR23117
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2036
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.