DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and dlg5

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_004916076.1 Gene:dlg5 / 779611 XenbaseID:XB-GENE-978275 Length:1971 Species:Xenopus tropicalis


Alignment Length:190 Identity:43/190 - (22%)
Similarity:81/190 - (42%) Gaps:35/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KKMTAPGPRPLVLCGP-SGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPE 91
            :::....|||:::.|| ..:.|..|:|    |.|..|       .|.|.|          |.:..
 Frog  1784 QRVDCTSPRPVLILGPLVDAVKDMLVK----ESPGKF-------CRCPLE----------VMKAS 1827

  Fly    92 MEAAIAGDE---FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIF- 152
            .:|...|.:   ||:....:|:...|:.|:::||..:...|:|||....:|::....:.||::| 
 Frog  1828 QQAIERGVKDCLFIDYKRRSGHFDVTTVASIKEITEKDCHCLLDIAPHAIERLHSVHIYPIVLFI 1892

  Fly   153 --NNPPSIKELERRLRKRGSETEESLSKRLNAA-QVELDYG------LTPGNFHKIINNV 203
              .:...|||.:..:..|...|::...::...| ::|.:|.      :..|....|.|.:
 Frog  1893 RYKSTKQIKEQKDPIFLRDKVTQKHSKEQFETAHKIEQEYSKYFTAVIQGGALFSICNQI 1952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 43/184 (23%)
guanyl_kin 36..216 CDD:213788 42/182 (23%)
dlg5XP_004916076.1 CARD 9..88 CDD:260018
Takusan 127..213 CDD:368141
Smc <136..544 CDD:224117
COG4372 443..>672 CDD:226809
PDZ_signaling 697..784 CDD:238492
PDZ_signaling 798..867 CDD:238492
PDZ 1395..1477 CDD:214570
dbPDZ_assoc 1475..1554 CDD:374667
PDZ 1554..1633 CDD:214570
SH3_DLG5 1649..1711 CDD:212794
GuKc 1784..1960 CDD:214504 43/190 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.