DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Mpp7

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_011245327.1 Gene:Mpp7 / 75739 MGIID:1922989 Length:601 Species:Mus musculus


Alignment Length:192 Identity:67/192 - (34%)
Similarity:101/192 - (52%) Gaps:18/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            |.:||.||.|.|.:.|.::|.......:|..:.||||..|..|..||.|.|:.:...|..:..::
Mouse   394 RLIVLVGPVGVGLNELKRKLLMSDAQHYGVIVPHTTRARRSQESDGVEYIFISKHLFETDVQNNK 458

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
            |||..|:..|.||||..:||.:.|:.:||:||::...|:.::..:..|.:||..||||:.| |..
Mouse   459 FIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERL-RET 522

  Fly   166 RK----------RGSE---TEESLSKRLNAAQV-ELDYGLTPGNFHKIINNVDIDVAYEEFR 213
            ||          :|:.   |||...:.:.:||: |..||..   |.|||.|.|:.||:.|.:
Mouse   523 RKNAKIISSRDDQGTAKPFTEEDFQEMIKSAQIMESQYGHL---FDKIIINDDLTVAFNELK 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 67/192 (35%)
guanyl_kin 36..216 CDD:213788 67/192 (35%)
Mpp7XP_011245327.1 L27 16..68 CDD:197794
L27 75..125 CDD:197794
PDZ_signaling 137..217 CDD:238492
SH3_MPP7 232..292 CDD:212966
GuKc 403..588 CDD:214504 62/183 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.