Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006506776.1 | Gene: | Lrguk / 74354 | MGIID: | 1921604 | Length: | 1341 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 58/199 - (29%) |
---|---|---|---|
Similarity: | 96/199 - (48%) | Gaps: | 8/199 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 TSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERP 90
Fly 91 EMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNP 155
Fly 156 PSIKELERRLRKRG----SETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFV 216
Fly 217 VQEL 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 54/188 (29%) |
guanyl_kin | 36..216 | CDD:213788 | 53/183 (29%) | ||
Lrguk | XP_006506776.1 | leucine-rich repeat | 131..150 | CDD:275380 | |
internalin_A | <132..>333 | CDD:380193 | |||
leucine-rich repeat | 151..172 | CDD:275380 | |||
leucine-rich repeat | 173..194 | CDD:275380 | |||
leucine-rich repeat | 195..216 | CDD:275380 | |||
leucine-rich repeat | 217..238 | CDD:275380 | |||
leucine-rich repeat | 258..281 | CDD:275380 | |||
leucine-rich repeat | 282..300 | CDD:275380 | |||
leucine-rich repeat | 304..328 | CDD:275380 | |||
GMPK | 416..537 | CDD:238026 | 35/121 (29%) | ||
PHA03247 | <678..1233 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |