DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Lrguk

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006506776.1 Gene:Lrguk / 74354 MGIID:1921604 Length:1341 Species:Mus musculus


Alignment Length:199 Identity:58/199 - (29%)
Similarity:96/199 - (48%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERP 90
            |...:.||.|. |:|.||:..||..|..||..:|.:.|.:...||||.|..||...|.|:|:.:.
Mouse   406 TLPSLDAPYPM-LILTGPAACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQE 469

  Fly    91 EMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNP 155
            ..:..:...:||.|..:..:.||.::..:..|...|....:.:|.:||..:|.:...|..|...|
Mouse   470 VFDEMLNMGKFILTFNYGNHNYGLNRDTIEGIARDGLASCIHMELEGVRSLKYSYFEPRYILVVP 534

  Fly   156 PSIKELERRLRKRG----SETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFV 216
            ...::.|..||::|    :|.|.::|:.....:|...|   ||.|..:||..|:|:||::....:
Mouse   535 MDKEKYEGYLRRKGLFSRAEIEIAVSRVDLYVKVNQKY---PGYFDAVINADDMDIAYQKLSELI 596

  Fly   217 VQEL 220
            .:.|
Mouse   597 REYL 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 54/188 (29%)
guanyl_kin 36..216 CDD:213788 53/183 (29%)
LrgukXP_006506776.1 leucine-rich repeat 131..150 CDD:275380
internalin_A <132..>333 CDD:380193
leucine-rich repeat 151..172 CDD:275380
leucine-rich repeat 173..194 CDD:275380
leucine-rich repeat 195..216 CDD:275380
leucine-rich repeat 217..238 CDD:275380
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..300 CDD:275380
leucine-rich repeat 304..328 CDD:275380
GMPK 416..537 CDD:238026 35/121 (29%)
PHA03247 <678..1233 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.