DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Pdzd2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001074533.1 Gene:Pdzd2 / 68070 MGIID:1922394 Length:2796 Species:Mus musculus


Alignment Length:199 Identity:47/199 - (23%)
Similarity:77/199 - (38%) Gaps:57/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSAAASLTSKKMTAP--GPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKP 74
            |::|.|..::|:..:.:.:|:|  .|:||    |.....:.....::.|..:    |...|:|.|
Mouse  1912 LAASGSLRTSASDTSIRTITSPLTSPKPL----PEQGANNRFHMAVYLESDT----SCPATSRPP 1968

  Fly    75 REGEEHGVHY-----YFVERPEMEAAIAGDEFIETAEFTG---NLYGTSKAAVREIQAQGRVCIL 131
            |.|.|..|.:     ..........|:||..  ::.:||.   :|..|..|     |.||     
Mouse  1969 RYGPEGKVPHANSGSVSPSASRTNIALAGVR--QSKQFTHSRVDLVLTEAA-----QPQG----- 2021

  Fly   132 DIEQKGVEQ-----IKRTDLNPILIFNN-----------PPSIKELERRLRKRG----SETEESL 176
             |.:||.|:     ::||:...|:..::           ||...      ||.|    |..:|..
Mouse  2022 -ISEKGTEKMASDPLERTNQLKIIEISSERMPKNACGDKPPGSD------RKGGFLTQSNCQEKS 2079

  Fly   177 SKRL 180
            |.||
Mouse  2080 SVRL 2083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 41/175 (23%)
guanyl_kin 36..216 CDD:213788 40/173 (23%)
Pdzd2NP_001074533.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 591..672 CDD:238492
PDZ_signaling 729..813 CDD:238492
PHA03307 1050..>1355 CDD:223039
PHA03247 <1197..1562 CDD:223021
PDZ_signaling 2581..2663 CDD:238492
PDZ 2709..2791 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.