Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074533.1 | Gene: | Pdzd2 / 68070 | MGIID: | 1922394 | Length: | 2796 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 77/199 - (38%) | Gaps: | 57/199 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LSSSSSSSSAAASLTSKKMTAP--GPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKP 74
Fly 75 REGEEHGVHY-----YFVERPEMEAAIAGDEFIETAEFTG---NLYGTSKAAVREIQAQGRVCIL 131
Fly 132 DIEQKGVEQ-----IKRTDLNPILIFNN-----------PPSIKELERRLRKRG----SETEESL 176
Fly 177 SKRL 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 41/175 (23%) |
guanyl_kin | 36..216 | CDD:213788 | 40/173 (23%) | ||
Pdzd2 | NP_001074533.1 | PDZ_signaling | 335..416 | CDD:238492 | |
PDZ_signaling | 591..672 | CDD:238492 | |||
PDZ_signaling | 729..813 | CDD:238492 | |||
PHA03307 | 1050..>1355 | CDD:223039 | |||
PHA03247 | <1197..1562 | CDD:223021 | |||
PDZ_signaling | 2581..2663 | CDD:238492 | |||
PDZ | 2709..2791 | CDD:214570 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |