Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071919.2 | Gene: | PALS1 / 64398 | HGNCID: | 18669 | Length: | 675 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 70/202 - (34%) |
---|---|---|---|
Similarity: | 103/202 - (50%) | Gaps: | 16/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 LTSKKMT-----APGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHY 84
Fly 85 YFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPI 149
Fly 150 LIFNNPPSIKELERRLRKRG-----SETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAY 209
Fly 210 EEFRNFV 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 66/188 (35%) |
guanyl_kin | 36..216 | CDD:213788 | 66/184 (36%) | ||
PALS1 | NP_071919.2 | Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions. /evidence=ECO:0000250|UniProtKB:Q9JLB2 | 1..345 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | ||||
Interaction with PARD6B. /evidence=ECO:0000250|UniProtKB:Q9JLB2 | 21..140 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 51..78 | ||||
L27_N | 123..170 | CDD:401122 | |||
Interaction with LIN7C. /evidence=ECO:0000250|UniProtKB:Q9JLB2 | 181..243 | ||||
L27 | 189..237 | CDD:197794 | |||
PDZ_signaling | 254..333 | CDD:238492 | |||
SH3_MPP5 | 349..411 | CDD:212969 | |||
GuKc | 491..661 | CDD:214504 | 61/175 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |