DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_038945240.1 Gene:Dlg2 / 64053 RGDID:619895 Length:1026 Species:Rattus norvegicus


Alignment Length:222 Identity:68/222 - (30%)
Similarity:113/222 - (50%) Gaps:27/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSAAASLTSKKMTAPGP---------RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSI 67
            :||::|.|.::.......:.:..|         ||:::.||.   |..:...|.:|||..||..:
  Rat   804 VSSNASDSESSCRGQEDLILSYEPVTRQEINYTRPVIILGPM---KDRINDDLISEFPDKFGSCV 865

  Fly    68 SHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCIL 131
            .||||..|:.|..|..|:|| .|.:||..|...:|||..::..||||||..:||.:..:|:.|||
  Rat   866 PHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCIL 930

  Fly   132 DIEQKGVEQIKRTDLNPILIFNNPPSIK---ELERRLRKRGSETEESLSKRLN-AAQVELDYGLT 192
            |:....:::::...|.||.||..|.|::   |:.:||      |||...|..: |.::|.::|  
  Rat   931 DVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRL------TEEQAKKTYDRAIKLEQEFG-- 987

  Fly   193 PGNFHKIINNVDIDVAYEEFRNFVVQE 219
             ..|..|:....::..|.:.: .|::|
  Rat   988 -EYFTAIVQGDTLEDIYNQCK-LVIEE 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 63/198 (32%)
guanyl_kin 36..216 CDD:213788 61/184 (33%)
Dlg2XP_038945240.1 L27_1 2..62 CDD:401120
MAGUK_N_PEST 157..239 CDD:402306
PDZ_signaling 240..324 CDD:238492
PDZ_signaling 333..418 CDD:238492
PDZ_assoc 420..487 CDD:402299
PDZ_signaling 561..639 CDD:238492
SH3_DLG2 676..749 CDD:212965
Guanylate_kin 835..1013 CDD:395500 63/191 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.