DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and lrguk

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_021330922.1 Gene:lrguk / 559670 ZFINID:ZDB-GENE-050419-232 Length:739 Species:Danio rerio


Alignment Length:211 Identity:63/211 - (29%)
Similarity:97/211 - (45%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERP 90
            |...:.||.|. |||.||...||..|..:|..||...|.:...||||.|..|||.|:.|:||...
Zfish   316 TLPSLDAPYPM-LVLTGPQACGKRELAHKLCQEFSDYFAYGACHTTRGPYFGEEDGLDYHFVTEE 379

  Fly    91 EMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNP 155
            |....|...:||:|.::.|:.||.|:.::..:..:|..|.:.:|.:||..:|.:...|..:...|
Zfish   380 EFHNMIQMGQFIQTMQYGGHWYGLSRESIERVAREGLACCVHMELEGVFSLKNSYFEPRYVLLIP 444

  Fly   156 PSIKELERRLRKRG----SETEESLSK-----RLNAAQVELDYGLTPGNFHKIINNVDIDVAYEE 211
            ..:......|:.||    ::.|.::|:     |:|..:        ||.|..||...|...||..
Zfish   445 SVVDNYVLFLKARGFYSNAQMETAVSRIDLYARINRER--------PGFFDSIIPCDDRAEAYRS 501

  Fly   212 FRNFVVQELKEQQKQG 227
            .:..|.:.|..::..|
Zfish   502 LKQLVKEYLGLEEHSG 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 58/193 (30%)
guanyl_kin 36..216 CDD:213788 56/188 (30%)
lrgukXP_021330922.1 LRR <25..>247 CDD:227223
leucine-rich repeat 61..82 CDD:275380
leucine-rich repeat 83..104 CDD:275380
leucine-rich repeat 105..126 CDD:275380
leucine-rich repeat 127..148 CDD:275380
leucine-rich repeat 149..168 CDD:275380
leucine-rich repeat 170..191 CDD:275380
leucine-rich repeat 192..210 CDD:275380
leucine-rich repeat 211..238 CDD:275380
GMPK 326..449 CDD:238026 41/123 (33%)
Herpes_ICP4_C 520..>739 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.