DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg3

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006528186.1 Gene:Dlg3 / 53310 MGIID:1888986 Length:867 Species:Mus musculus


Alignment Length:223 Identity:74/223 - (33%)
Similarity:116/223 - (52%) Gaps:24/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NRALSSSSSSSSAAASLTSKKMTAPG---PRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHT 70
            |.:.|.|||.....|.|:.:.:|...   .||:::.||.   |..:...|.:|||..||..:.||
Mouse   648 NTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPM---KDRVNDDLISEFPHKFGSCVPHT 709

  Fly    71 TRKPREGEEHGVHYYF-VERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIE 134
            ||..|:.|..|..|:| |.|.:||..|..::|||..:|..||||||..:||.:..:|:.||||:.
Mouse   710 TRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVS 774

  Fly   135 QKGVEQIKRTDLNPILIFNNPPSIK---ELERRLRKRGSETEESLSKRLN-AAQVELDYGLTPGN 195
            ...::::::..|.||.||..|.||:   |:.||      :|.|..:|..: |.::|.::|   ..
Mouse   775 GNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRR------QTYEQANKIFDKAMKLEQEFG---EY 830

  Fly   196 FHKIINNVDIDVAYEEFRNFVVQELKEQ 223
            |..|:....:    ||..|.:.|.:::|
Mouse   831 FTAIVQGDSL----EEIYNKIKQIIEDQ 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 64/192 (33%)
guanyl_kin 36..216 CDD:213788 64/184 (35%)
Dlg3XP_006528186.1 MAGUK_N_PEST 52..148 CDD:371162
PDZ_signaling 149..226 CDD:238492
PDZ_signaling 242..328 CDD:238492
PDZ_assoc 329..403 CDD:371157
PDZ_signaling 402..480 CDD:238492
SH3_DLG3 520..586 CDD:212962
Guanylate_kin 676..854 CDD:366206 65/193 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.