DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and PALS2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001289966.1 Gene:PALS2 / 51678 HGNCID:18167 Length:540 Species:Homo sapiens


Alignment Length:198 Identity:63/198 - (31%)
Similarity:106/198 - (53%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            :.|||.|..|.|:.:|..|.....|:.||.::..|:|||||.|:.|..|.||.|.||||.|...:
Human   339 KTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGK 403

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
            ::|..|:.||||||...::.|:...||.||||:..:.::.::.::..|.::|...|.::.| |.:
Human   404 YLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETL-RAM 467

  Fly   166 RKRGSE--------TEESLSKRLN-AAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELK 221
            .|...:        |:..|.|.:: :|:::..|.   ..|..||.|.::|.|:|:.:..:.:...
Human   468 HKAVVDAGITTKLLTDSDLKKTVDESARIQRAYN---HYFDLIIINDNLDKAFEKLQTAIEKLRM 529

  Fly   222 EQQ 224
            |.|
Human   530 EPQ 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 61/191 (32%)
guanyl_kin 36..216 CDD:213788 61/188 (32%)
PALS2NP_001289966.1 L27 2..55 CDD:197794
L27 57..108 CDD:397114
PDZ_signaling 133..206 CDD:238492
SH3_MPP6 219..279 CDD:212971
Guanylate_kin 337..527 CDD:395500 61/191 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.