DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Mpp2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001343253.1 Gene:Mpp2 / 50997 MGIID:1858257 Length:569 Species:Mus musculus


Alignment Length:247 Identity:64/247 - (25%)
Similarity:112/247 - (45%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNRALSSSSSSSSAAASLTSKKM-----------------------TAPGP----RPLVLCGPSG 45
            |.|.|..:.:|.:...||:.||.                       .|..|    :.|||.|..|
Mouse   313 VKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQG 377

  Fly    46 SGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGN 110
            .|:.:|..:|....|..:|.::.:|:|:|::.|..|..|.||.|.||||.|....::|..|:.||
Mouse   378 VGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGN 442

  Fly   111 LYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPP---SIKELERRLRKRGSET 172
            ||||...::|.:.|.|:||:||:..:.|:.::..:..|.::|...|   :::.:.|...:.|..|
Mouse   443 LYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVST 507

  Fly   173 EESLSKRL-----NAAQVELDYG------LTPGNFHKIINNVDIDVAYEEFR 213
            ::.....|     .:::::..||      |...|..:...  ::..|.|:.|
Mouse   508 KQLTEADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFR--ELQTAMEKLR 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 55/198 (28%)
guanyl_kin 36..216 CDD:213788 54/192 (28%)
Mpp2NP_001343253.1 L27 30..83 CDD:197794
L27 85..136 CDD:308467
PDZ_signaling 155..233 CDD:238492
SH3_MPP2 246..304 CDD:212970
GuKc 376..557 CDD:214504 49/182 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.