DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and sdt

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001033835.2 Gene:sdt / 44861 FlyBaseID:FBgn0261873 Length:2020 Species:Drosophila melanogaster


Alignment Length:193 Identity:61/193 - (31%)
Similarity:104/193 - (53%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            ||:||.||...|:..|.:||.|: ...|..::.||:|..||||..||.|:|:.|...||.|....
  Fly  1820 RPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARR 1883

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
            |:|..|:....||||..|:|.:.|.|::|:|::..:.::.::.:||.|.::...|||:.:|.::.
  Fly  1884 FVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKK 1948

  Fly   166 RKRGSETEESLSKRL--NAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQQKQ 226
            .:.|...:|...|.:  .|..:|..:|..   |..||.|.|.:.||.:    ::.|:...:::
  Fly  1949 LRNGEPFKEEELKDIIATARDMEARWGHL---FDMIIINNDTERAYHQ----LLAEINSLERE 2004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 60/184 (33%)
guanyl_kin 36..216 CDD:213788 60/181 (33%)
sdtNP_001033835.2 PDZ_signaling <54..102 CDD:238492
L27 1423..1466 CDD:295425
PDZ_signaling 1562..1640 CDD:238492
SH3_MPP5 1673..1734 CDD:212969
Guanylate_kin 1820..1994 CDD:279019 60/181 (33%)
GuKc 1831..2002 CDD:214504 55/178 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.