DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and MPP1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_002427.1 Gene:MPP1 / 4354 HGNCID:7219 Length:466 Species:Homo sapiens


Alignment Length:171 Identity:50/171 - (29%)
Similarity:88/171 - (51%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            :.|||.|.||.|:|.:...|.::.|..|.:.:.:|||.||:.||.|..|:|:...||...|:.:|
Human   283 KTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANE 347

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
            |:|...:.||::||....|.:|..|.::.|||||.:.::.::..:|:|.::|..|..        
Human   348 FLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTD-------- 404

  Fly   166 RKRGSETEESLSKRLNAAQVELDYGLTPGNFH----KIINN 202
              :|::||.....:.::..:...|.      |    .::||
Human   405 --QGTQTEALQQLQKDSEAIRSQYA------HYFDLSLVNN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 50/171 (29%)
guanyl_kin 36..216 CDD:213788 50/171 (29%)
MPP1NP_002427.1 PDZ 71..149 CDD:366185
SH3_MPP1 162..223 CDD:213013
Interaction with PALS1. /evidence=ECO:0000269|PubMed:17584769 268..466 50/171 (29%)
Guanylate_kin 281..453 CDD:366206 50/171 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.