DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and mpp2b

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005156123.1 Gene:mpp2b / 431770 ZFINID:ZDB-GENE-040704-70 Length:561 Species:Danio rerio


Alignment Length:202 Identity:58/202 - (28%)
Similarity:101/202 - (50%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            :.|||.|..|.|:.:|..:|....|..:|.:..:|:|||:..|:.|..|.|:.|.|||..|....
Zfish   360 KTLVLIGAQGVGRRSLKNKLLVSDPHRYGTTTPYTSRKPKVDEKEGQMYLFMSRSEMETDIKCGR 424

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPS---IKELE 162
            |:|..|:.||||||...::.|:...|::||||:..:.::.::..:..|.::|...|:   :|::.
Zfish   425 FLEHGEYDGNLYGTKIDSIHEVVDSGKICILDVNPQALKVLRTAEFLPYVVFIEAPNFEVLKDMN 489

  Fly   163 RRLRKRGSETEESLSKRL-----NAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKE 222
            |...:.|..|::.....|     .:.:::..|.   ..|...|.|.::|.||...|..:.:...:
Zfish   490 RSAIEAGVVTKQMTDSELKRTVDESERIQRAYS---HYFDLSIVNDNLDGAYRSLRRALDRLNTD 551

  Fly   223 QQKQGVS 229
            ||...||
Zfish   552 QQWVPVS 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 54/190 (28%)
guanyl_kin 36..216 CDD:213788 54/187 (29%)
mpp2bXP_005156123.1 L27 76..127 CDD:280918
PDZ_signaling 148..226 CDD:238492
SH3_MPP2 239..297 CDD:212970
Guanylate_kin 358..546 CDD:279019 54/188 (29%)
GuKc 368..546 CDD:214504 50/180 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.