Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005156123.1 | Gene: | mpp2b / 431770 | ZFINID: | ZDB-GENE-040704-70 | Length: | 561 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 58/202 - (28%) |
---|---|---|---|
Similarity: | 101/202 - (50%) | Gaps: | 11/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
Fly 101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPS---IKELE 162
Fly 163 RRLRKRGSETEESLSKRL-----NAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKE 222
Fly 223 QQKQGVS 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 54/190 (28%) |
guanyl_kin | 36..216 | CDD:213788 | 54/187 (29%) | ||
mpp2b | XP_005156123.1 | L27 | 76..127 | CDD:280918 | |
PDZ_signaling | 148..226 | CDD:238492 | |||
SH3_MPP2 | 239..297 | CDD:212970 | |||
Guanylate_kin | 358..546 | CDD:279019 | 54/188 (29%) | ||
GuKc | 368..546 | CDD:214504 | 50/180 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |