DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and CASK

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster


Alignment Length:141 Identity:43/141 - (30%)
Similarity:76/141 - (53%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            :.|||.|..|.|:..:...|.:::|..:.:.|.||||..:..||:|..||||...||.|.|..:|
  Fly   712 KTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANE 776

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKEL---E 162
            ::|.......:|||....:|.|..:|::.|||:|.:.::.::..:..|.::|...||::.:   :
  Fly   777 YLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADYD 841

  Fly   163 RRLRKRGSETE 173
            ..|.:...|:|
  Fly   842 GSLERLAKESE 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 43/141 (30%)
guanyl_kin 36..216 CDD:213788 43/141 (30%)
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996
S_TKc 12..278 CDD:214567
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019 43/141 (30%)
GuKc 720..883 CDD:214504 39/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.