Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243118.1 | Gene: | pals2a / 402878 | ZFINID: | ZDB-GENE-050506-35 | Length: | 550 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 66/205 - (32%) |
---|---|---|---|
Similarity: | 105/205 - (51%) | Gaps: | 15/205 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
Fly 101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
Fly 166 RKRGSE--------TEESLSKRLN-AAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELK 221
Fly 222 EQQKQGVSVN 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 60/191 (31%) |
guanyl_kin | 36..216 | CDD:213788 | 59/188 (31%) | ||
pals2a | NP_001243118.1 | L27 | 13..66 | CDD:197794 | |
L27 | 68..119 | CDD:308467 | |||
PDZ_signaling | 138..216 | CDD:238492 | |||
SH3_MPP | 229..286 | CDD:212796 | |||
Guanylate_kin | 347..537 | CDD:331880 | 61/193 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |