DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and pals2a

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001243118.1 Gene:pals2a / 402878 ZFINID:ZDB-GENE-050506-35 Length:550 Species:Danio rerio


Alignment Length:205 Identity:66/205 - (32%)
Similarity:105/205 - (51%) Gaps:15/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            :.|||.|..|.|:.:|..||....|..:|.::..|:|:||:.|:.|..|.||.|.|||..|....
Zfish   349 KTLVLIGAQGVGRRSLKNRLIVLNPLRYGTTVPFTSRRPRDDEKDGQSYCFVSREEMEMDIKASR 413

  Fly   101 FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRL 165
            ::|..|:.||||||...::.|:...||.||||:..:.::.:|.::..|.::|...|.:..| |.:
Zfish   414 YLEHGEYDGNLYGTKMDSIHEVVRAGRTCILDVNPQALKVLKTSEFMPFVVFIAAPELDTL-RAM 477

  Fly   166 RKRGSE--------TEESLSKRLN-AAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELK 221
            .|...:        ||..|.|.:: :|:::..|.   ..|...|.|.::|.|:|:.:..|  |..
Zfish   478 HKAVVDAGITTKLLTETDLKKTVDESARIKRAYN---HYFDLTIVNDNLDKAFEKLQAAV--EQL 537

  Fly   222 EQQKQGVSVN 231
            ..|.|.|.||
Zfish   538 TTQPQWVPVN 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 60/191 (31%)
guanyl_kin 36..216 CDD:213788 59/188 (31%)
pals2aNP_001243118.1 L27 13..66 CDD:197794
L27 68..119 CDD:308467
PDZ_signaling 138..216 CDD:238492
SH3_MPP 229..286 CDD:212796
Guanylate_kin 347..537 CDD:331880 61/193 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.