DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and guk1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001034818.1 Gene:guk1 / 394964 XenbaseID:XB-GENE-979074 Length:213 Species:Xenopus tropicalis


Alignment Length:208 Identity:111/208 - (53%)
Similarity:144/208 - (69%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSSSAAASLTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHG 81
            ||.|....:|:..|.  ||||:||.||||:|||||||||..|:...||||:||||||||.||..|
 Frog     3 SSWSKVFRVTAAGMA--GPRPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRPGEADG 65

  Fly    82 VHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDL 146
            ..|:||...:|:..|...||||.|.|:||:||||.|||:.:||:.::|||||:.:||:.||:|.|
 Frog    66 KDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQGVKSIKKTSL 130

  Fly   147 NPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEE 211
            |||.|..:|||:..||:|||.|.:|:||||.||||||..:|:....||.|..||.|.|::.||..
 Frog   131 NPIYISIHPPSVPILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLFDAIIVNDDLEEAYAH 195

  Fly   212 FRNFVVQELKEQQ 224
            .:..:.||:|:.|
 Frog   196 LKGTLAQEIKQAQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 102/184 (55%)
guanyl_kin 36..216 CDD:213788 100/179 (56%)
guk1NP_001034818.1 guanyl_kin 20..197 CDD:213788 100/176 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 198 1.000 Domainoid score I3032
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H665
Inparanoid 1 1.050 212 1.000 Inparanoid score I3554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522834at2759
OrthoFinder 1 1.000 - - FOG0002663
OrthoInspector 1 1.000 - - oto103759
Panther 1 1.100 - - LDO PTHR23117
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2036
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.