DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and metro

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster


Alignment Length:239 Identity:73/239 - (30%)
Similarity:104/239 - (43%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSAAASLTSKKM------------------------TAPGP-RPLVLCGPSGSGKSTL 51
            |.:|||:||.....|.|.|                        ..||. ||:||.|..|.|::.|
  Fly   341 LPASSSTSSCRQPKTKKIMYDLTENDDFDREQIATYEEVAKLYPRPGVFRPIVLIGAPGVGRNEL 405

  Fly    52 LKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSK 116
            .:||.|..|..|...:.:|||..|.||..|..|.||.|.:|:|.|...:|:|..|:.|:|||||.
  Fly   406 RRRLIARDPEKFRSPVPYTTRPMRTGEVAGREYIFVAREKMDADIEAGKFVEHGEYKGHLYGTSA 470

  Fly   117 AAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKEL-----ERRLRKRGSE----- 171
            .:|:.|...|.||:|....:.::.::...|.|.||...||.:..|     |.|.:....|     
  Fly   471 ESVKSIVNAGCVCVLSPHYQAIKTLRTAQLKPFLIHVKPPELDILKATRTEARAKSTFDEANARS 535

  Fly   172 -TEESLSKRLNAAQ-----------VELDYGLTPGNFHKIINNV 203
             |:|.....:.:|:           |||..|.....|.:::.||
  Fly   536 FTDEEFEDMIKSAERIDFLYGHFFDVELVNGELVNAFEQLVQNV 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 63/193 (33%)
guanyl_kin 36..216 CDD:213788 62/190 (33%)
metroNP_610642.2 L27 17..68 CDD:197794
L27 75..127 CDD:197794
PDZ_signaling 139..229 CDD:238492
SH3_MPP 243..302 CDD:212796
Guanylate_kin 390..575 CDD:279019 60/184 (33%)
GuKc 399..580 CDD:214504 57/181 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.