DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and vari

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster


Alignment Length:248 Identity:80/248 - (32%)
Similarity:116/248 - (46%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AASLTSKKMTAPGP---RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVH 83
            |..|..:::|...|   :.|||.|.||.|:.||..||.......||..|.||:|..|..||:|..
  Fly   393 AELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSS 457

  Fly    84 YYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILD---------------- 132
            |:|::|.|||.|:..:||:|..|..||||||...:::::...||:||||                
  Fly   458 YWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELM 522

  Fly   133 -----IEQKGVEQIK-------RTDLNPILIFNNPPSIKELERRLRKRGS-----ETEESLSKRL 180
                 :...|:||:|       .|..|..|.|:...||:...||.|...|     |.::.::...
  Fly   523 PFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVE 587

  Fly   181 NAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKE--QQKQGVSVN 231
            .::.|:..|   ...|..:|.|.|.|   |.||. ||:.|.:  .::|.|.||
  Fly   588 ESSFVQRKY---EKYFDMVIVNEDFD---ETFRQ-VVETLDQMSHEEQWVPVN 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 72/220 (33%)
guanyl_kin 36..216 CDD:213788 69/212 (33%)
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019 72/220 (33%)
GuKc 418..622 CDD:214504 68/210 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.