DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and dlg1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001162718.1 Gene:dlg1 / 32083 FlyBaseID:FBgn0001624 Length:1030 Species:Drosophila melanogaster


Alignment Length:207 Identity:44/207 - (21%)
Similarity:79/207 - (38%) Gaps:52/207 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSA-----AASLTSKKMTAPGPR----PLVLCGPSGSGKSTLLKRLFAE--------F 59
            |::|.|.|..     |..:.:.:.|.||.|    .::...|.|:.::...:.:..|        .
  Fly   686 LATSQSQSQVHQQQHATPMVNSQSTEPGSRYASTNVLAAVPPGTPRAVSTEDITREPRTITIQKG 750

  Fly    60 PSTFGFSISHTTRKPREGEE-HGVHYYFVER-------PEMEAAIAGDEFIETAEFTGNL-YGTS 115
            |...||:|.       .||: .|::..|:..       .|::   .||:.:.....  || :.|.
  Fly   751 PQGLGFNIV-------GGEDGQGIYVSFILAGGPADLGSELK---RGDQLLSVNNV--NLTHATH 803

  Fly   116 KAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERR--LRKRGSET-EESLS 177
            :.|.:.::..|.|..| :.|...|:..|.:..          |:||:::  |...||.| ..:..
  Fly   804 EEAAQALKTSGGVVTL-LAQYRPEEYNRFEAR----------IQELKQQAALGAGGSGTLLRTTQ 857

  Fly   178 KRLNAAQVELDY 189
            ||....:...||
  Fly   858 KRSLYVRALFDY 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 37/180 (21%)
guanyl_kin 36..216 CDD:213788 36/178 (20%)
dlg1NP_001162718.1 L27_1 303..359 CDD:286187
PDZ 454..540 CDD:214570
PDZ_signaling 566..655 CDD:238492
PDZ_signaling 742..820 CDD:238492 18/90 (20%)
SH3_DLG-like 862..922 CDD:212795 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.