DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Card10

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_038935185.1 Gene:Card10 / 315120 RGDID:1304949 Length:1109 Species:Rattus norvegicus


Alignment Length:102 Identity:26/102 - (25%)
Similarity:46/102 - (45%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AIAGDEFIETAEFTGNLYGTSKA---------AVREIQAQ--GRVCILDIEQKGVEQIKRTDLNP 148
            :::|:|     :.|.:..|..||         .:|.||..  .:.|:|::..:||.::..:::.|
  Rat   956 SLSGEE-----QCTSSAPGAPKAWPASAGLGSRIRAIQESVGKKHCLLELGARGVRELVHSEVYP 1015

  Fly   149 ILIF-----NNPPSIKELERR--------LRK-RGSE 171
            |:|.     .|...|:.|..|        ||: ||||
  Rat  1016 IVIHVEVTEKNVREIRSLLGRPGWRDSELLRQCRGSE 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 26/102 (25%)
guanyl_kin 36..216 CDD:213788 26/102 (25%)
Card10XP_038935185.1 CARD_CARD10_CARMA3 76..161 CDD:260069
Smc <196..>499 CDD:224117
SH3 784..849 CDD:418401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.