Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017456050.1 | Gene: | Mpp7 / 307035 | RGDID: | 1305675 | Length: | 601 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 68/200 - (34%) |
---|---|---|---|
Similarity: | 105/200 - (52%) | Gaps: | 18/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 KKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEM 92
Fly 93 EAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPS 157
Fly 158 IKELERRLRK----------RGSE---TEESLSKRLNAAQV-ELDYGLTPGNFHKIINNVDIDVA 208
Fly 209 YEEFR 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 67/193 (35%) |
guanyl_kin | 36..216 | CDD:213788 | 67/191 (35%) | ||
Mpp7 | XP_017456050.1 | L27 | 16..68 | CDD:197794 | |
L27 | <88..125 | CDD:197794 | |||
PDZ_signaling | 137..217 | CDD:238492 | |||
SH3_MPP7 | 232..292 | CDD:212966 | |||
GuKc | 409..588 | CDD:214504 | 60/176 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |