DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and mpp7a

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_021335692.1 Gene:mpp7a / 30166 ZFINID:ZDB-GENE-991209-8 Length:621 Species:Danio rerio


Alignment Length:223 Identity:66/223 - (29%)
Similarity:109/223 - (48%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDE 100
            |.:||.||:|.|.:.|.::|.......|..:|.||:|..|..|..||.|:|:.:...||.|..::
Zfish   395 RLVVLVGPTGVGLNELKRKLLISDTQHFSVTIPHTSRSKRHQESEGVEYHFISKNLFEADIQNNK 459

  Fly   101 -------------------FIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDL 146
                               |||..|:.||.||||..:||.:.::.:||:||::...::.::..:.
Zfish   460 KSGYSCFWRSSLPVLQRNRFIEHGEYKGNYYGTSFDSVRSVLSKNKVCLLDVQPHTLKHLRTAEF 524

  Fly   147 NPILIFNNPPSIKELERRLR----------KRGSE--TEESLSKRLNAAQ-VELDYGLTPGNFHK 198
            .|.::|..||.|:.|....|          |..|:  :||...:.::|:| :|..||..   |.|
Zfish   525 KPYVVFVKPPCIERLRETRRNAKVISGKDDKTSSKAFSEEDFLEMISASQMMENQYGHL---FEK 586

  Fly   199 IINNVDIDVAYEEFRNFVVQELKEQQKQ 226
            :|.|.|:.||:.|.:    |.||:.:.:
Zfish   587 VIVNDDLTVAFSELK----QALKKVETE 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 63/214 (29%)
guanyl_kin 36..216 CDD:213788 63/211 (30%)
mpp7aXP_021335692.1 L27 12..68 CDD:197794
L27 74..125 CDD:197794
PDZ_signaling 137..217 CDD:238492
SH3 232..292 CDD:327375
GuKc 403..608 CDD:214504 61/211 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.