DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and GUK1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005273161.1 Gene:GUK1 / 2987 HGNCID:4693 Length:263 Species:Homo sapiens


Alignment Length:194 Identity:109/194 - (56%)
Similarity:138/194 - (71%) Gaps:0/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAG 98
            ||||:||.||||:|||||||||..|....||||:|||||.||.|||:|..||||.|..|:..||.
Human    69 GPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAA 133

  Fly    99 DEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELER 163
            .:|||.|||:||||||||.||:.:||..|:|:||::.:||..||.|||.||.|...|||:..||:
Human   134 GDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQ 198

  Fly   164 RLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQQKQG 227
            |||:|.:||||||.|||.|||.:::....||.|..:|.|..:|.||.|.:..:.:|:|:.|:.|
Human   199 RLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 105/184 (57%)
guanyl_kin 36..216 CDD:213788 103/179 (58%)
GUK1XP_005273161.1 Guanylate_kin 69..254 CDD:279019 105/184 (57%)
guanyl_kin 71..253 CDD:213788 103/181 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153108
Domainoid 1 1.000 205 1.000 Domainoid score I2949
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H665
Inparanoid 1 1.050 218 1.000 Inparanoid score I3598
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62608
OrthoDB 1 1.010 - - D1522834at2759
OrthoFinder 1 1.000 - - FOG0002663
OrthoInspector 1 1.000 - - oto89951
orthoMCL 1 0.900 - - OOG6_100603
Panther 1 1.100 - - LDO PTHR23117
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R636
SonicParanoid 1 1.000 - - X2036
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.