DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg4

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_062567.1 Gene:Dlg4 / 29495 RGDID:68424 Length:724 Species:Rattus norvegicus


Alignment Length:215 Identity:72/215 - (33%)
Similarity:109/215 - (50%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSSSSSSAAASL----TSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKP 74
            |||.|.....|:    |..:|.....||:::.||:   |......|.:|||..||..:.||||..
  Rat   509 SSSGSQGREDSVLSYETVTQMEVHYARPIIILGPT---KDRANDDLLSEFPDKFGSCVPHTTRPK 570

  Fly    75 REGEEHGVHYYFV-ERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGV 138
            ||.|..|..|:|| .|.:||..|...:|||..::..:|||||..:|||:..||:.||||:....|
  Rat   571 REYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAV 635

  Fly   139 EQIKRTDLNPILIFNNPPSIK---ELERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKII 200
            .:::...|:||.||..|.|::   |:.:|:      |||...|..:.| .:|:...|. .|..|:
  Rat   636 RRLQAAHLHPIAIFIRPRSLENVLEINKRI------TEEQARKAFDRA-TKLEQEFTE-CFSAIV 692

  Fly   201 NNVDIDVAYEEFRNFVVQEL 220
            .....:..|.:.:. |:::|
  Rat   693 EGDSFEEIYHKVKR-VIEDL 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 64/188 (34%)
guanyl_kin 36..216 CDD:213788 63/183 (34%)
Dlg4NP_062567.1 MAGUK_N_PEST 10..64 CDD:287565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..35
PDZ 65..149 CDD:278991
PDZ 160..244 CDD:278991
PDZ_assoc 245..312 CDD:287558
PDZ 310..394 CDD:214570
SH3_DLG4 430..495 CDD:212963
Guanylate_kin 533..711 CDD:279019 64/189 (34%)
GuKc 544..710 CDD:214504 60/174 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.