DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and caska

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_017213110.1 Gene:caska / 259195 ZFINID:ZDB-GENE-020802-4 Length:965 Species:Danio rerio


Alignment Length:182 Identity:55/182 - (30%)
Similarity:91/182 - (50%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEME 93
            |:.|...:.|||.|..|.|:..:...|..:.|..|.:.|.||||.|::.||:|.:|:||...:|.
Zfish   763 KLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMM 827

  Fly    94 AAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSI 158
            ..|:.::::|.......:|||....:|:|..||.:.|||:|.:.::.::..:..|.::|...|:|
Zfish   828 QDISNNDYLEYGSHEDAMYGTRLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPYVVFIAAPTI 892

  Fly   159 ----KELERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDID 206
                .||.|..||...|:.:.|.|.....|....:     .|.:.|.|.:||
Zfish   893 TPGMNELPRWCRKLPDESLQRLQKESEILQKTYAH-----YFDQTIINNEID 939

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 53/177 (30%)
guanyl_kin 36..216 CDD:213788 53/175 (30%)
caskaXP_017213110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.