DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_038943929.1 Gene:Dlg1 / 25252 RGDID:2505 Length:939 Species:Rattus norvegicus


Alignment Length:192 Identity:66/192 - (34%)
Similarity:99/192 - (51%) Gaps:19/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGD 99
            ||:::.||.   |..:...|.:|||..||..:.||||..|:.|..|..|:|| .|.:||..|...
  Rat   750 RPVIILGPM---KDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEH 811

  Fly   100 EFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPS---IKEL 161
            :|||..::..:|||||..:||.:..:|:.||||:....:::::...|.||.||..|.|   |.|:
  Rat   812 KFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEM 876

  Fly   162 ERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQ 223
            .:||      |:|...|....| |.|:...|. :|..|:....:    |:..|.|.|.::||
  Rat   877 NKRL------TDEQARKTFERA-VRLEQEFTE-HFTAIVQGDTL----EDIYNQVKQIIEEQ 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 63/186 (34%)
guanyl_kin 36..216 CDD:213788 62/183 (34%)
Dlg1XP_038943929.1 PDZ_signaling 224..308 CDD:238492
PDZ_signaling 317..403 CDD:238492
PDZ_assoc 404..465 CDD:402299
PDZ 463..547 CDD:214570
SH3_DLG1 582..648 CDD:212964
Guanylate_kin 748..926 CDD:395500 64/190 (34%)
L27_1 2..62 CDD:401120
MAGUK_N_PEST 106..223 CDD:402306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.