DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11811 and Magi3

DIOPT Version :9

Sequence 1:	NP_648408.1	Gene:	CG11811 / 39213	FlyBaseID:	FBgn0036099	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_620784.3	Gene:	Magi3 / 245903	RGDID:	621362	Length:	1470	Species:	Rattus norvegicus

Alignment Length:	122	Identity:	34/122 - (27%)
Similarity:	51/122 - (41%)	Gaps:	16/122 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 SISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQ----G 126
            :|..|||.||:||..||.|.|:...:.:|.......:|:..:.||.|||.|........|    .
  Rat   144 TIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVD 208

  Fly   127 RVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAA 183
            :| :.|.|.....|.|||           .|:.::||.......|.|:...:.:|.:
  Rat   209 QV-LFDNEFDTESQRKRT-----------TSVSKMERMDSSLPEEEEDEDKEAVNGS 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11811	NP_648408.1	Guanylate_kin	34..219	CDD:279019	34/122 (28%)
CG11811	NP_648408.1	guanyl_kin	36..216	CDD:213788	34/122 (28%)
Magi3	NP_620784.3	Interaction with ADRB1 and TGFA. /evidence=ECO:0000269\|PubMed:16316992	18..108
		PDZ_signaling	24..103	CDD:238492
		NK	125..>199	CDD:418433	20/54 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	184..266		20/82 (24%)
		HUL4	<211..>373	CDD:227354	12/54 (22%)
		WW	299..329	CDD:238122
		WW	345..375	CDD:238122
		Interaction with PTEN. /evidence=ECO:0000250	413..495
		PDZ	416..496	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	550..575
		PDZ	578..659	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	665..700
		PDZ	729..812	CDD:214570
		Interaction with ADGRB1. /evidence=ECO:0000250	729..811
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	818..847
		PDZ_signaling	851..936	CDD:238492
		Interaction with LPAR2 and GRIN2B. /evidence=ECO:0000250	852..939
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	939..976
		PDZ_signaling	1023..1101	CDD:238492
		PTZ00112	1115..>1405	CDD:240274
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1124..1146
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1167..1470
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0194
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900