DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006507830.1 Gene:Dlg2 / 23859 MGIID:1344351 Length:1027 Species:Mus musculus


Alignment Length:222 Identity:68/222 - (30%)
Similarity:113/222 - (50%) Gaps:27/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSAAASLTSKKMTAPGP---------RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSI 67
            :||::|.|.::.......:.:..|         ||:::.||.   |..:...|.:|||..||..:
Mouse   805 VSSNASDSESSCRGQEDLILSYEPVTRQEINYTRPVIILGPM---KDRINDDLISEFPDKFGSCV 866

  Fly    68 SHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCIL 131
            .||||..|:.|..|..|:|| .|.:||..|...:|||..::..||||||..:||.:..:|:.|||
Mouse   867 PHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCIL 931

  Fly   132 DIEQKGVEQIKRTDLNPILIFNNPPSIK---ELERRLRKRGSETEESLSKRLN-AAQVELDYGLT 192
            |:....:::::...|.||.||..|.|::   |:.:||      |||...|..: |.::|.::|  
Mouse   932 DVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRL------TEEQAKKTYDRAIKLEQEFG-- 988

  Fly   193 PGNFHKIINNVDIDVAYEEFRNFVVQE 219
             ..|..|:....::..|.:.: .|::|
Mouse   989 -EYFTAIVQGDTLEDIYNQCK-LVIEE 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 63/198 (32%)
guanyl_kin 36..216 CDD:213788 61/184 (33%)
Dlg2XP_006507830.1 L27_1 4..63 CDD:370268
MAGUK_N_PEST 158..240 CDD:371162
PDZ_signaling 241..325 CDD:238492
PDZ_signaling 334..419 CDD:238492
PDZ_assoc 421..488 CDD:371157
PDZ_signaling 562..640 CDD:238492
SH3_DLG2 677..750 CDD:212965
Guanylate_kin 836..1014 CDD:366206 63/191 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.