DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and PDZD2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005248326.1 Gene:PDZD2 / 23037 HGNCID:18486 Length:2873 Species:Homo sapiens


Alignment Length:207 Identity:40/207 - (19%)
Similarity:69/207 - (33%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSSSSSSSSAAASLTSKKMTAP-----GPRPLVLC-------GPSGSGKSTLLKRLFAEFPSTFG 64
            |.:.::...|:|.:.|.|.:.|     .||....|       ||..|..|:||:           
Human  1617 LPTQAAICPASAKVLSLKYSTPRESVASPREKAACLPGSYTSGPDSSQPSSLLE----------- 1670

  Fly    65 FSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVC 129
                      ...:||..|        .:.:.:.:.....||.|..:...|.|            
Human  1671 ----------MSSQEHETH--------ADISTSQNHRPSCAEETTEVTSASSA------------ 1705

  Fly   130 ILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVELDYGL-TP 193
               :|...:.::.|...:|.:|.::|..:..||..|  ...||.......:|||.....:.: .|
Human  1706 ---MENSPLSKVARHFHSPPIILSSPNMVNGLEHDL--LDDETLNQYETSINAAASLSSFSVDVP 1765

  Fly   194 GNFHKIINNVDI 205
            .|...::.|:.|
Human  1766 KNGESVLENLHI 1777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 34/180 (19%)
guanyl_kin 36..216 CDD:213788 33/178 (19%)
PDZD2XP_005248326.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 589..670 CDD:238492
PDZ_signaling 726..810 CDD:238492
PDZ_signaling 2623..2694 CDD:238492
PDZ 2785..2867 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.