Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005248326.1 | Gene: | PDZD2 / 23037 | HGNCID: | 18486 | Length: | 2873 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 40/207 - (19%) |
---|---|---|---|
Similarity: | 69/207 - (33%) | Gaps: | 59/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LSSSSSSSSAAASLTSKKMTAP-----GPRPLVLC-------GPSGSGKSTLLKRLFAEFPSTFG 64
Fly 65 FSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVC 129
Fly 130 ILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVELDYGL-TP 193
Fly 194 GNFHKIINNVDI 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 34/180 (19%) |
guanyl_kin | 36..216 | CDD:213788 | 33/178 (19%) | ||
PDZD2 | XP_005248326.1 | PDZ_signaling | 335..416 | CDD:238492 | |
PDZ_signaling | 589..670 | CDD:238492 | |||
PDZ_signaling | 726..810 | CDD:238492 | |||
PDZ_signaling | 2623..2694 | CDD:238492 | |||
PDZ | 2785..2867 | CDD:214570 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |