DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Mpp4

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001158154.1 Gene:Mpp4 / 227157 MGIID:2386681 Length:654 Species:Mus musculus


Alignment Length:213 Identity:67/213 - (31%)
Similarity:108/213 - (50%) Gaps:23/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNRALSSSSSSSSAAAS-----LTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSI 67
            ::.:|..|.|..||..:     :..::..|...|.:||.||||.|.:.|.::|....||.|..::
Mouse   413 LHASLCCSCSCYSAVGAPYEEVVRYQRQPADKHRLIVLVGPSGVGVNELRRQLIGCNPSCFQSAV 477

  Fly    68 SHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILD 132
            .||||.|:..|..|..|::|.|...|:.:.|.:.:|..|:.|:|||||..||..:..:|::||:|
Mouse   478 PHTTRFPKSYEMDGREYHYVSRETFESLMYGHKMLEYGEYKGHLYGTSVNAVHAVLDEGKICIMD 542

  Fly   133 IEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSET----------EESLSKRLNAAQ-VE 186
            :|.:.::..:..||.|.:||..||:...: |..||....|          :|.|.:....|| :|
Mouse   543 LEPQDIQSARTRDLKPYVIFIKPPNTSSM-RHSRKNAKITTDYYVDMKFKDEDLQEMEELAQKME 606

  Fly   187 LDYGLTPGNF--HKIINN 202
            ..:    |.|  |.|:|:
Mouse   607 SQF----GQFFDHVIVND 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 61/182 (34%)
guanyl_kin 36..216 CDD:213788 61/180 (34%)
Mpp4NP_001158154.1 L27 <66..100 CDD:197794
L27 108..154 CDD:280918
PDZ_signaling 171..250 CDD:238492
SH3_MPP4 264..324 CDD:212967
Guanylate_kin 446..636 CDD:279019 61/180 (34%)
GuKc 454..637 CDD:214504 56/172 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.